PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890953.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 311aa    MW: 34226.5 Da    PI: 8.3527
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890953.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.4e-382888262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +++ +kcprC+s ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+++
  XP_015890953.1 28 QQQPQKCPRCESLNTKFCYYNNYSLSQPRYFCKTCRRYWTQGGTLRNVPVGGGCRKGKRAK 88
                    68999***************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-251186IPR003851Zinc finger, Dof-type
PfamPF027016.5E-333086IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7053286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MQPEREEMNL EDRRLKPEPE NQQQHQQQQQ PQKCPRCESL NTKFCYYNNY SLSQPRYFCK  60
TCRRYWTQGG TLRNVPVGGG CRKGKRAKTS TSGQNSRSQA QPEPPLPPQQ PSQQVQQNMA  120
NPPAIISSGS VMTTTPAMRT IEPGALPSQY YPGSGYLSSL AAIHSLNQSQ PFDQALDVGT  180
DQLAGNNSSN MSLLQGFSVS SFGSQQQQQH QIQPSQTHFY QTAGNRDKSI NESLYQSEEN  240
LIQTAAGRST SSSSPHEWPH NFMNTSGATT ASSESALWTM GNTKATANTT SAGSSFNPNQ  300
WPDLPGYGPP P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890953.10.0PREDICTED: dof zinc finger protein DOF4.4-like isoform X1
TrEMBLA0A0D2UNM97e-89A0A0D2UNM9_G
STRINGPOPTR_0004s04590.16e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-33OBF binding protein 4